PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00099.132
Common NameAMTR_s00099p00145100, LOC18427815
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family ZF-HD
Protein Properties Length: 268aa    MW: 30350.3 Da    PI: 8.5807
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00099.132genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.31.1e-3058113359
                               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                               + +Y+eCl+NhAas+Gg+a+DGCgEfm++ g egt+++lkC+ C+CHRnFHR+e+e 
  evm_27.model.AmTr_v1.0_scaffold00099.132  58 TPKYRECLRNHAASMGGNATDGCGEFMAA-GPEGTPESLKCSVCNCHRNFHRKETEG 113
                                               679*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015664.7E-2860110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2160114IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.2E-2860111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.94261110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.6E-30192264IPR009057Homeodomain-like
SuperFamilySSF466893.59E-19193263IPR009057Homeodomain-like
TIGRFAMsTIGR015652.1E-27202258IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MDESMPIPIT TTYTPSAHHL IHDSPPPPNH HQIIPSTNGP QTLEREREDL HSYKKNSTPK  60
YRECLRNHAA SMGGNATDGC GEFMAAGPEG TPESLKCSVC NCHRNFHRKE TEGEDTPSPC  120
ESCFLLKSRK KSGLLISTGP ETYGYPTPPL VQRPPPAMAT PPMMVSYNLG PPHNHHHHHH  180
QPSESDEHEE RENSFRAPLM VKKRFRTKFT QEQKEKMLSF AEKVGWRIQK QEEGVVQQFC  240
QEIGVKRRVL KVWMHNNKHN LAKKASS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A1e-242012601675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00258DAPTransfer from AT2G02540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011621016.10.0PREDICTED: zinc-finger homeodomain protein 2
SwissprotO647222e-63ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLW1NVZ60.0W1NVZ6_AMBTC; Uncharacterized protein
STRINGVIT_12s0035g01880.t012e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69600.12e-39zinc finger homeodomain 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]